Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty Acid-Binding Protein 6/FABP6/I-BABP (N-6His)

Source: E.coli. MW :16.6kD. Recombinant Human FABP6 is produced by our E.coli expression system and the target gene encoding Met1-Ala128 is expressed with a 6His tag at the N-terminus. Fatty Acid-Binding Protein 6 (FABP6) is cytoplasmic protein that binds long-chain fatty acids and other hydrophobic ligands which belongs to the calycin superfamily. FABP6 expression is restricted in the small intestine to the ileum where it is involved in the enterohepatic circulation of bile acids. FABP6 forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior. Isoform 2 is expressed in colorectal adenocarcinomas and their adjacent normal mucosa (at protein level) . Isoform 1 is expressed in the jejunum, ileum, cecum and ascending colon intestine. FABP6 plays a role in fatty acid uptake, transport, and metabolism. FABP6 stimulates gastric acid and pepsinogen secretion. It seems to be able to bind to bile salts and bilirubins.

Product Specifications

Gene Name

FABP6

Gene ID

2172

UniProt

P51161

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 0.5mM DTT, 50% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lymphocyte Antigen 6C1, Recombinant, Mouse, aa27-109, His-SUMOSTAR-Tag (Ly6c1)
405979-01 20 µg

Lymphocyte Antigen 6C1, Recombinant, Mouse, aa27-109, His-SUMOSTAR-Tag (Ly6c1)

Ask
View Details
Lymphocyte Antigen 6C1, Recombinant, Mouse, aa27-109, His-SUMOSTAR-Tag (Ly6c1)
405979-02 100 µg

Lymphocyte Antigen 6C1, Recombinant, Mouse, aa27-109, His-SUMOSTAR-Tag (Ly6c1)

Ask
View Details
Cyclizine Lactate
TRC-C987440-500MG 500 mg

Cyclizine Lactate

Ask
View Details
Rabbit anti-Influenza A virus M1 Polyclonal Antibody
MBS7162029 Inquire

Rabbit anti-Influenza A virus M1 Polyclonal Antibody

Ask
View Details
Anti-FOXP1 Antibody (3V901)
MF-0074640-01 25 µL

Anti-FOXP1 Antibody (3V901)

Ask
View Details
Anti-FOXP1 Antibody (3V901)
MF-0074640-02 50 µL

Anti-FOXP1 Antibody (3V901)

Ask
View Details