Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty Acid-Binding Protein 6/FABP6/I-BABP (N-6His)

Source: E.coli. MW :16.6kD. Recombinant Human FABP6 is produced by our E.coli expression system and the target gene encoding Met1-Ala128 is expressed with a 6His tag at the N-terminus. Fatty Acid-Binding Protein 6 (FABP6) is cytoplasmic protein that binds long-chain fatty acids and other hydrophobic ligands which belongs to the calycin superfamily. FABP6 expression is restricted in the small intestine to the ileum where it is involved in the enterohepatic circulation of bile acids. FABP6 forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior. Isoform 2 is expressed in colorectal adenocarcinomas and their adjacent normal mucosa (at protein level) . Isoform 1 is expressed in the jejunum, ileum, cecum and ascending colon intestine. FABP6 plays a role in fatty acid uptake, transport, and metabolism. FABP6 stimulates gastric acid and pepsinogen secretion. It seems to be able to bind to bile salts and bilirubins.

Product Specifications

Gene Name

FABP6

Gene ID

2172

UniProt

P51161

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 0.5mM DTT, 50% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Research Grade Letolizumab
HB199016-01 100 µg

Research Grade Letolizumab

Ask
View Details
Research Grade Letolizumab
HB199016-02 1 mg

Research Grade Letolizumab

Ask
View Details
Beta crystallin S (CRYGS) (NM_017541) Human Mass Spec Standard
PH310159 10 µg

Beta crystallin S (CRYGS) (NM_017541) Human Mass Spec Standard

Ask
View Details
ZBED1 Antibody, HRP conjugated
A39224-50UG 50 µg

ZBED1 Antibody, HRP conjugated

Ask
View Details
CAMP-dependent Protein Kinase Catalytic Subunit Alpha, Recombinant, Human, aa2-351, His-Tag discontinued
583879-01 20 µg

CAMP-dependent Protein Kinase Catalytic Subunit Alpha, Recombinant, Human, aa2-351, His-Tag discontinued

Ask
View Details
CAMP-dependent Protein Kinase Catalytic Subunit Alpha, Recombinant, Human, aa2-351, His-Tag discontinued
583879-02 100 µg

CAMP-dependent Protein Kinase Catalytic Subunit Alpha, Recombinant, Human, aa2-351, His-Tag discontinued

Ask
View Details