Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclophilin E/PPIase E/PPIE (N-6His)

Source: E.coli. MW :35.6kD. Recombinant Human Cyclophilin E is produced by our E.coli expression system and the target gene encoding Met1-Val301 is expressed with a 6His tag at the N-terminus. Peptidyl-prolyl cis-trans isomerase E, also known as Cyclophilin E, Cyclophilin-33, Rotamase E, CYP33, PPIE, is an enzyme which belongs to the cyclophilin-type PPIase family of PPIase E subfamily. PPIE found in all the examined tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. PPIE contains one PPIase cyclophilin-type domain and one RRM (RNA recognition motif) domain. PPIE accelerates the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIE combines RNA-binding and PPIase activities. It may be involved in muscle- and brain-specific processes and pre-mRNA spliciing.

Product Specifications

Gene Name

PPIE

Gene ID

10450

UniProt

Q9UNP9

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FAM19A4 (TAFA4) (NM_182522) Human Tagged Lenti ORF Clone
RC206792L4 10 µg

FAM19A4 (TAFA4) (NM_182522) Human Tagged Lenti ORF Clone

Ask
View Details
Ovary Lysate
MBS151634-01 0.1 mg

Ovary Lysate

Ask
View Details
Ovary Lysate
MBS151634-02 5x 0.1 mg

Ovary Lysate

Ask
View Details
Recombinant N-Acetyl Alpha-D-Glucosaminidase (NAGLU)
SIPD669Ra01-01 10 µg

Recombinant N-Acetyl Alpha-D-Glucosaminidase (NAGLU)

Ask
View Details
Recombinant N-Acetyl Alpha-D-Glucosaminidase (NAGLU)
SIPD669Ra01-02 50 µg

Recombinant N-Acetyl Alpha-D-Glucosaminidase (NAGLU)

Ask
View Details
Recombinant N-Acetyl Alpha-D-Glucosaminidase (NAGLU)
SIPD669Ra01-03 200 µg

Recombinant N-Acetyl Alpha-D-Glucosaminidase (NAGLU)

Ask
View Details