Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclophilin E/PPIase E/PPIE (N-6His)

Source: E.coli. MW :35.6kD. Recombinant Human Cyclophilin E is produced by our E.coli expression system and the target gene encoding Met1-Val301 is expressed with a 6His tag at the N-terminus. Peptidyl-prolyl cis-trans isomerase E, also known as Cyclophilin E, Cyclophilin-33, Rotamase E, CYP33, PPIE, is an enzyme which belongs to the cyclophilin-type PPIase family of PPIase E subfamily. PPIE found in all the examined tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. PPIE contains one PPIase cyclophilin-type domain and one RRM (RNA recognition motif) domain. PPIE accelerates the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIE combines RNA-binding and PPIase activities. It may be involved in muscle- and brain-specific processes and pre-mRNA spliciing.

Product Specifications

Gene Name

PPIE

Gene ID

10450

UniProt

Q9UNP9

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Leucine zipper putative tumor suppressor 3 (LZTS3) ELISA Kit
abx531897 96 Tests

Mouse Leucine zipper putative tumor suppressor 3 (LZTS3) ELISA Kit

Ask
View Details
Rabbit Polyclonal JMJD5 Antibody [Alexa Fluor 750]
NBP1-77074AF750 0.1 mL

Rabbit Polyclonal JMJD5 Antibody [Alexa Fluor 750]

Ask
View Details
Equine Melatonin,MT/ MLT ELISA Kit
ELA-E0908ELA-Eq 96 Tests

Equine Melatonin,MT/ MLT ELISA Kit

Ask
View Details
Recombinant Arabidopsis thaliana Probable pectinesterase 55 (PME55)
MBS1366617-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Probable pectinesterase 55 (PME55)

Ask
View Details
Recombinant Arabidopsis thaliana Probable pectinesterase 55 (PME55)
MBS1366617-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Probable pectinesterase 55 (PME55)

Ask
View Details
Recombinant Arabidopsis thaliana Probable pectinesterase 55 (PME55)
MBS1366617-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Probable pectinesterase 55 (PME55)

Ask
View Details