Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclophilin C/PPIase C/PPIC (N-Trx, 6His)

Source: E.coli. MW :33.78kD. Recombinant Human Cyclophilin C is produced by our E.coli expression system and the target gene encoding Lys31-Asp182 is expressed with a Trx, 6His tag at the N-terminus. Cyclophilin C is an enzyme (EC 5.2.1.8) found in both prokaryotes and eukaryotes that interconverts the cis and trans isomers of peptide bonds with the amino acid proline. Proline has an unusually conformationally restrained peptide bond due to its cyclic structure with its side chain bonded to its secondary amine nitrogen. Most amino acids have a strong energetic preference for the trans peptide bond conformation due to steric hindrance, but prolines unusual structure stabilizes the cis form so that both isomers are populated under biologically relevant conditions. Proteins with prolyl isomerase activity include cyclophilin, FKBPs, and parvulin, although larger proteins can also contain prolyl isomerase domains.

Product Specifications

Gene Name

PPIC

Gene ID

5480

UniProt

P45877

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATD
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

H-Orn(Z)-OBzl·HCl
5-05076 25 g

H-Orn(Z)-OBzl·HCl

Ask
View Details
1700066M21Rik Mouse Gene Knockout Kit (CRISPR)
KN500156 1 Kit

1700066M21Rik Mouse Gene Knockout Kit (CRISPR)

Ask
View Details
OR5F1 cDNA Clone
MBS1275674-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

OR5F1 cDNA Clone

Ask
View Details
OR5F1 cDNA Clone
MBS1275674-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

OR5F1 cDNA Clone

Ask
View Details
Integrin beta 3 Rabbit Monoclonal Antibody [KD Validation]
E51K68733 40 µL

Integrin beta 3 Rabbit Monoclonal Antibody [KD Validation]

Ask
View Details
IL2RA (Interleukin-2 Receptor Subunit alpha, IL-2 Receptor Subunit alpha, IL-2-RA, IL-2R Subunit alpha, IL2-RA, TAC Antigen, p55, CD25)
128459 100 µg

IL2RA (Interleukin-2 Receptor Subunit alpha, IL-2 Receptor Subunit alpha, IL-2-RA, IL-2R Subunit alpha, IL2-RA, TAC Antigen, p55, CD25)

Ask
View Details