Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclophilin C/PPIase C/PPIC (N-Trx, 6His)

Source: E.coli. MW :33.78kD. Recombinant Human Cyclophilin C is produced by our E.coli expression system and the target gene encoding Lys31-Asp182 is expressed with a Trx, 6His tag at the N-terminus. Cyclophilin C is an enzyme (EC 5.2.1.8) found in both prokaryotes and eukaryotes that interconverts the cis and trans isomers of peptide bonds with the amino acid proline. Proline has an unusually conformationally restrained peptide bond due to its cyclic structure with its side chain bonded to its secondary amine nitrogen. Most amino acids have a strong energetic preference for the trans peptide bond conformation due to steric hindrance, but prolines unusual structure stabilizes the cis form so that both isomers are populated under biologically relevant conditions. Proteins with prolyl isomerase activity include cyclophilin, FKBPs, and parvulin, although larger proteins can also contain prolyl isomerase domains.

Product Specifications

Gene Name

PPIC

Gene ID

5480

UniProt

P45877

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATD
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Formimidoyltransferase Cyclodeaminase (FTCD) ELISA Kit
abx387426 96 Tests

Human Formimidoyltransferase Cyclodeaminase (FTCD) ELISA Kit

Ask
View Details
Recombinant Human RCC2 Protein, N-His
MBS1579321-01 0.1 mg

Recombinant Human RCC2 Protein, N-His

Ask
View Details
Recombinant Human RCC2 Protein, N-His
MBS1579321-02 1 mg

Recombinant Human RCC2 Protein, N-His

Ask
View Details
Recombinant Human RCC2 Protein, N-His
MBS1579321-03 5x 1 mg

Recombinant Human RCC2 Protein, N-His

Ask
View Details
IFI27 (NM_001288958) Human Tagged ORF Clone
RG235764 10 µg

IFI27 (NM_001288958) Human Tagged ORF Clone

Ask
View Details
Human Ephrin Type A Receptor 1, EPHA1 ELISA KIT
E2442Hu-01 48 Well

Human Ephrin Type A Receptor 1, EPHA1 ELISA KIT

Ask
View Details