Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chloride Intracellular Channel Protein 5/CLIC5 (N-6His)

Source: E.coli. MW :30.3kD. Recombinant Human CLIC5 is produced by our E.coli expression system and the target gene encoding Met1-Ser251 is expressed with a 6His tag at the N-terminus. Chloride Intracellular Channel Protein 5 (CLIC5) is a single-pass membrane protein which belongs to the chloride channel CLIC family. It contains one GST C-terminal domain. Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIC5 can insert into membranes and form selective ion channels regulated by actin that may transport chloride ions. It may play a role in the regulation of transepithelial ion absorption and secretion. CLIC5 specifically associates with the cytoskeleton of placenta microvilli. CLIC5 is required for the development and/or maintenance of the proper glomerular endothelial cell and podocyte architecture.

Product Specifications

Gene Name

CLIC5

Gene ID

53405

UniProt

Q9NZA1

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ALG8 (NM_024079) Human Tagged Lenti ORF Clone
RC200914L1 10 µg

ALG8 (NM_024079) Human Tagged Lenti ORF Clone

Ask
View Details
Bovine TCDD-Inducible Poly [ADP-Ribose] Polymerase (TIPARP) ELISA Kit
MBS9913774-01 48 Well

Bovine TCDD-Inducible Poly [ADP-Ribose] Polymerase (TIPARP) ELISA Kit

Ask
View Details
Bovine TCDD-Inducible Poly [ADP-Ribose] Polymerase (TIPARP) ELISA Kit
MBS9913774-02 96 Well

Bovine TCDD-Inducible Poly [ADP-Ribose] Polymerase (TIPARP) ELISA Kit

Ask
View Details
Bovine TCDD-Inducible Poly [ADP-Ribose] Polymerase (TIPARP) ELISA Kit
MBS9913774-03 5x 96 Well

Bovine TCDD-Inducible Poly [ADP-Ribose] Polymerase (TIPARP) ELISA Kit

Ask
View Details
Bovine TCDD-Inducible Poly [ADP-Ribose] Polymerase (TIPARP) ELISA Kit
MBS9913774-04 10x 96 Well

Bovine TCDD-Inducible Poly [ADP-Ribose] Polymerase (TIPARP) ELISA Kit

Ask
View Details
Frozen Tissue Sections, Lung
CS600223 5x 5 µm

Frozen Tissue Sections, Lung

Ask
View Details