Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LMW-PTP/ACP1 (C-6His)

Source: E.coli. MW :19.04kD. Recombinant Human LMW-PTP is produced by our E.coli expression system and the target gene encoding Ala2-His158 is expressed with a 6His tag at the C-terminus. Low Molecular Weight Phosphotyrosine Protein Phosphatase (LMW-PTP) is a member of the low molecular weight phosphotyrosine protein phosphatase family. LMW-PTP serves as an acid phosphatase and a protein tyrosine phosphatase (PTPase) by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. LMW-PTP can be detected in all human tissues, including adipocytes. LMW-PTP is a cytosolic enzyme that regulate cell proliferation and growth of leiomyomas during dephosphorylation of the PDGF receptor. In addition, LMW-PTP plays an important role in the regulation of physiological functions, such as stress resistance and synthesis of the polysaccharide capsule.

Product Specifications

Gene Name

ACP1

Gene ID

52

UniProt

P24666

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 10% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAHLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ombrabulin (hydrochloride)
HY-18256-01 5 mg

Ombrabulin (hydrochloride)

Ask
View Details
Ombrabulin (hydrochloride)
HY-18256-02 10 mM - 1 mL

Ombrabulin (hydrochloride)

Ask
View Details
Ombrabulin (hydrochloride)
HY-18256-03 10 mg

Ombrabulin (hydrochloride)

Ask
View Details
Ombrabulin (hydrochloride)
HY-18256-04 25 mg

Ombrabulin (hydrochloride)

Ask
View Details
Ombrabulin (hydrochloride)
HY-18256-05 50 mg

Ombrabulin (hydrochloride)

Ask
View Details
Ombrabulin (hydrochloride)
HY-18256-06 100 mg

Ombrabulin (hydrochloride)

Ask
View Details