Recombinant Human EIF4E-Binding Protein 1/EIF4EBP1 (N-6His)
Source: E.coli. MW :14.74kD. Recombinant Human EIF4E-Binding Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Ile118 is expressed with a 6His tag at the N-terminus. Eukaryotic Translation Initiation Factor 4E-Binding Protein 1 (4EBP1) is a number of the eIF4E-binding protein family. 4EBP1 regulates eIF4E activity by preventing its assembly into the eIF4F complex. 4EBP1 mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways. Non-phosphorylated 4EBP1 competes with EIF4G1/EIF4G3 to interact with EIF4E. 4EBP1 is phosphorylated in response to various signals including insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation. 4EBP1 has a role in progression of breast neoplasms through cell signaling.
Product Specifications
Gene Name
EIF4EBP1
Gene ID
1978
UniProt
Q13541
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MGSSHHHHHHSSGLVPRGSHMSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items