Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet-Derived Growth Factor BB/PDGF-BB

Source: E.coli. MW :12.42kD. Recombinant Human Platelet-Derived Growth Factor BB is produced by our E.coli expression system and the target gene encoding Ser82-Thr190 is expressed. Platelet-Derived Growth Factor Subunit B (PDGFB) belongs to the PDGF/VEGF growth factor family. Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma.Binding of PDGFB to its receptor elicits a variety of cellular responses. In addition, PDGFB is released by platelets upon wounding and plays an important role in stimulating adjacent cells to grow and thereby heals the wound.

Product Specifications

Gene Name

PDGFB

Gene ID

5155

UniProt

P01127

Components

Lyophilized from a 0.2 μm filtered solution of 4mM HCl.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal SNAP25 Antibody (OTI4G5) [DyLight 405]
NBP2-74245V 0.1 mL

Mouse Monoclonal SNAP25 Antibody (OTI4G5) [DyLight 405]

Ask
View Details
NPS3A, ID (NIPSNAP3A, NIPSNAP4, Protein NipSnap homolog 3A, Protein NipSnap homolog 4, Target for Salmonella secreted protein C) (MaxLight 650)
MBS6326355-01 0.1 mL

NPS3A, ID (NIPSNAP3A, NIPSNAP4, Protein NipSnap homolog 3A, Protein NipSnap homolog 4, Target for Salmonella secreted protein C) (MaxLight 650)

Ask
View Details
NPS3A, ID (NIPSNAP3A, NIPSNAP4, Protein NipSnap homolog 3A, Protein NipSnap homolog 4, Target for Salmonella secreted protein C) (MaxLight 650)
MBS6326355-02 5x 0.1 mL

NPS3A, ID (NIPSNAP3A, NIPSNAP4, Protein NipSnap homolog 3A, Protein NipSnap homolog 4, Target for Salmonella secreted protein C) (MaxLight 650)

Ask
View Details
Human B4GALT1 PicoKine ELISA Kit
MBS1751663-01 96 Well

Human B4GALT1 PicoKine ELISA Kit

Ask
View Details
Human B4GALT1 PicoKine ELISA Kit
MBS1751663-02 5x 96 Well

Human B4GALT1 PicoKine ELISA Kit

Ask
View Details
Recombinant Burkholderia cenocepacia Ribosome-binding factor A (rbfA)
MBS1418558-01 0.02 mg (E-Coli)

Recombinant Burkholderia cenocepacia Ribosome-binding factor A (rbfA)

Ask
View Details