Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet-Derived Growth Factor BB/PDGF-BB

Source: E.coli. MW :12.42kD. Recombinant Human Platelet-Derived Growth Factor BB is produced by our E.coli expression system and the target gene encoding Ser82-Thr190 is expressed. Platelet-Derived Growth Factor Subunit B (PDGFB) belongs to the PDGF/VEGF growth factor family. Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma.Binding of PDGFB to its receptor elicits a variety of cellular responses. In addition, PDGFB is released by platelets upon wounding and plays an important role in stimulating adjacent cells to grow and thereby heals the wound.

Product Specifications

Gene Name

PDGFB

Gene ID

5155

UniProt

P01127

Components

Lyophilized from a 0.2 μm filtered solution of 4mM HCl.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human NMB Protein, N-GST
YHC37501 100 μg

Recombinant Human NMB Protein, N-GST

Ask
View Details
Ergic3 (BC057130) Mouse Recombinant Protein
PM46701M5 20 µg

Ergic3 (BC057130) Mouse Recombinant Protein

Ask
View Details
(Rac) -Vepdegestrant
MF-0008898-01 10 mg

(Rac) -Vepdegestrant

Ask
View Details
(Rac) -Vepdegestrant
MF-0008898-02 50 mg

(Rac) -Vepdegestrant

Ask
View Details
PPP2R5C Protein Vector (Human) (pPM-C-HA)
37484021 500 ng

PPP2R5C Protein Vector (Human) (pPM-C-HA)

Ask
View Details
Biotin-Linked Antibody to Peroxiredoxin 3 (PRDX3)
MBS2005065-01 0.1 mL

Biotin-Linked Antibody to Peroxiredoxin 3 (PRDX3)

Ask
View Details