Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serpin A12/Vaspin (N-GST)

Source: E.coli. MW :71.4kD. Recombinant Human Serpin A12 is produced by our E.coli expression system and the target gene encoding Leu21-Lys414 is expressed with a GST tag at the N-terminus. Vaspin (Visceral Adipose-Specific SERPIN) is a newly described adipokine. Vaspin has three beta-sheets, nine a-helices, and one central loop; the structure is part of the set of distinctive features that are descriptive of Serpin family members. Vaspin is also a unique insulin sensitizing adipocytokine in obesity. A recent publication indicates that Vaspin mRNA expression in visceral fat is positively correlated with BMI and percent of body fat. and could be associated with parameters of obesity, insulin resistance, and glucose metabolism. These findings suggest a potential clinical use for Vaspin in ameliorating certain aberrations seen in the obesity metabolic syndrome.

Product Specifications

Gene Name

SERPINA12

Gene ID

145264

UniProt

Q8IW75

Components

Supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 160mM NaCl, 0.2mM PMSF, 1mM DTT, 10% Glycerine, pH 7.2 .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Connexin 43 Blocking Peptide
CBP3230-01 1 mg

Connexin 43 Blocking Peptide

Ask
View Details
Connexin 43 Blocking Peptide
CBP3230-02 5 mg

Connexin 43 Blocking Peptide

Ask
View Details
INSM2 Human Pre-designed siRNA Set A
HY-RS06845 1 Set

INSM2 Human Pre-designed siRNA Set A

Ask
View Details
NAP1L4 Human shRNA Plasmid Kit (Locus ID 4676)
TL311271 1 Kit

NAP1L4 Human shRNA Plasmid Kit (Locus ID 4676)

Ask
View Details
Recombinant Mycoplasma penetrans Glucose-6-phosphate isomerase (pgi)
MBS1325689-01 0.02 mg (E-Coli)

Recombinant Mycoplasma penetrans Glucose-6-phosphate isomerase (pgi)

Ask
View Details
Recombinant Mycoplasma penetrans Glucose-6-phosphate isomerase (pgi)
MBS1325689-02 0.02 mg (Yeast)

Recombinant Mycoplasma penetrans Glucose-6-phosphate isomerase (pgi)

Ask
View Details