Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase 14/USP14 (N-6His)

Source: E.coli. MW :48.45kD. Recombinant Human USP14 is produced by our E.coli expression system and the target gene encoding Asp91-Gln494 is expressed with a 6His tag at the N-terminus. Ubiquitin Carboxyl-Terminal Hydrolase 14 (USP14) belongs to the ubiquitin-specific processing (USP) family which is a deubiquitinating enzyme (DUB) with His and Cys domains. USP14 located in the cytoplasm is a proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. USP14 acts also as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under the non-stressed condition by inhibiting the degradation of unfolded endoplasmic reticulum proteins via interaction with ERN1. In addition, USP14 is indispensable for synaptic development and function at neuromuscular junctions, required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis.

Product Specifications

Gene Name

USP14

Gene ID

9097

UniProt

P54578

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 20% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
More Discoveries

Explore Other Products

Browse additional items from our catalog

NOX4, NT (NOX4, RENOX, NADPH oxidase 4, Kidney oxidase-1, Kidney superoxide-producing NADPH oxidase, Renal NAD (P) H-oxidase) (MaxLight 650) discontinued
039072-ML650 100 µL

NOX4, NT (NOX4, RENOX, NADPH oxidase 4, Kidney oxidase-1, Kidney superoxide-producing NADPH oxidase, Renal NAD (P) H-oxidase) (MaxLight 650) discontinued

Sign In for Pricing
View Details
TRANK1 Protein Vector (Human) (pPB-N-His)
PV137111 500 ng

TRANK1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
ITFG1 Knockout MES-OV Polyclonal Cells
ARG24662 1 Million

ITFG1 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
Rabbit Monoclonal Integrin beta 7 Antibody (FIB27) [Alexa Fluor 532]
NBP2-81087AF532 0.1 mL

Rabbit Monoclonal Integrin beta 7 Antibody (FIB27) [Alexa Fluor 532]

Sign In for Pricing
View Details
SOX17 Human Gene Knockout Kit (CRISPR)
KN220888 1 Kit

SOX17 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Heat shock protein 15 homolog (hslR)
MBS1073876-01 0.02 mg (E-Coli)

Recombinant Haemophilus influenzae Heat shock protein 15 homolog (hslR)

Sign In for Pricing
View Details