Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uteroglobin-Related Protein 1/UGRP1

Source: E.coli. MW :7.9kD. Recombinant Human Uteroglobin-Related Protein 1 is produced by our E.coli expression system and the target gene encoding Phe22-Val93 is expressed. Uteroglobin-Related Protein 1 (UGRP1) belongs to the secretoglobin family which has been suggested to play a role in lung inflammation and allergic diseases. UGRP1 is a 17 kDa secreted homodimeric protein that shows amino acid sequence similarity with uteroglobin. UGRP1 is expressed predominantly in the lung and low levels of expression are detected in the thyroid. Expression of UGRP1 in lung epithelial cells is enhanced by IL-10 and decreased through the activities of IL-9 and IL-5. UGRP1 interacts with the macrophage scavenger receptor with collagenous structure which is expressed by alveolar macrophages in the lung. It have suggested that UGRP1 may be involved in inflammation and pathogen clearance in the lung by binding to its receptor.

Product Specifications

Gene Name

SCGB3A2

Gene ID

117156

UniProt

Q96PL1

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TFIID Polyclonal Antibody
UB-GEN-2063 100 µL

TFIID Polyclonal Antibody

Ask
View Details
Pla2g5 Antibody
A31339-100UG 100 µg

Pla2g5 Antibody

Ask
View Details
Ifit1 Mouse shRNA Plasmid (Locus ID 15957)
TL501042 1 Kit

Ifit1 Mouse shRNA Plasmid (Locus ID 15957)

Ask
View Details
Recombinant Anti-GM-CSF Receptor alpha Antibody (APC), Rabbit Monoclonal
MBS8103627-01 25 Tests

Recombinant Anti-GM-CSF Receptor alpha Antibody (APC), Rabbit Monoclonal

Ask
View Details
Recombinant Anti-GM-CSF Receptor alpha Antibody (APC), Rabbit Monoclonal
MBS8103627-02 100 Tests

Recombinant Anti-GM-CSF Receptor alpha Antibody (APC), Rabbit Monoclonal

Ask
View Details
Recombinant Anti-GM-CSF Receptor alpha Antibody (APC), Rabbit Monoclonal
MBS8103627-03 5x 100 Tests

Recombinant Anti-GM-CSF Receptor alpha Antibody (APC), Rabbit Monoclonal

Ask
View Details