Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L3/UCH-L3 (C-6His)

Source: E.coli. MW :27.25kD. Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L3 is produced by our E.coli expression system and the target gene encoding Met1-Ala230 is expressed with a 6His tag at the C-terminus. Ubiquitin Carboxyl-Terminal Hydrolases (UCHs) are a family of cysteine hydrolases. They catalyze the hydrolysis of amides, thioesters and esters, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin. Up regulation of UCHL3 is associated with uterine cervical neoplasms. UCHL3 is implicated in age related cognitive disorders. UCHL3 also promotes adipogenesis and insulin signaling. In mice, UCHL3 knockout have been shown to be resistant to diet-induced obesity.

Product Specifications

Gene Name

UCHL3

Gene ID

7347

UniProt

P15374

Components

Supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 150mM NaCl, 1mM DTT, 50% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAALEHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Leptin tA Ovine
PT-A03278-01 10 µg

Leptin tA Ovine

Sign In for Pricing
View Details
Leptin tA Ovine
PT-A03278-02 50 µg

Leptin tA Ovine

Sign In for Pricing
View Details
Leptin tA Ovine
PT-A03278-03 1 mg

Leptin tA Ovine

Sign In for Pricing
View Details
ENKD1 siRNA (Human)
MBS8204643-01 15 nmol

ENKD1 siRNA (Human)

Sign In for Pricing
View Details
ENKD1 siRNA (Human)
MBS8204643-02 30 nmol

ENKD1 siRNA (Human)

Sign In for Pricing
View Details
ENKD1 siRNA (Human)
MBS8204643-03 5x 30 nmol

ENKD1 siRNA (Human)

Sign In for Pricing
View Details