Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L3/UCH-L3 (C-6His)

Source: E.coli. MW :27.25kD. Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L3 is produced by our E.coli expression system and the target gene encoding Met1-Ala230 is expressed with a 6His tag at the C-terminus. Ubiquitin Carboxyl-Terminal Hydrolases (UCHs) are a family of cysteine hydrolases. They catalyze the hydrolysis of amides, thioesters and esters, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin. Up regulation of UCHL3 is associated with uterine cervical neoplasms. UCHL3 is implicated in age related cognitive disorders. UCHL3 also promotes adipogenesis and insulin signaling. In mice, UCHL3 knockout have been shown to be resistant to diet-induced obesity.

Product Specifications

Gene Name

UCHL3

Gene ID

7347

UniProt

P15374

Components

Supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 150mM NaCl, 1mM DTT, 50% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAALEHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat soluble Interleukin 2 Receptor Alpha (sIL-2Rα) ELISA Kit
NSL0564Gt 96 Tests

Goat soluble Interleukin 2 Receptor Alpha (sIL-2Rα) ELISA Kit

Sign In for Pricing
View Details
HSV1/HSV2 quantitative
HSV/GP/025 25 Tests

HSV1/HSV2 quantitative

Sign In for Pricing
View Details
LIPF (Lipase (Gastric) Human ELISA Kit
E7054 96 Tests

LIPF (Lipase (Gastric) Human ELISA Kit

Sign In for Pricing
View Details
Protransforming Growth factor alpha (Biotin)
331155-01 50 µg

Protransforming Growth factor alpha (Biotin)

Sign In for Pricing
View Details
Protransforming Growth factor alpha (Biotin)
331155-02 100 µg

Protransforming Growth factor alpha (Biotin)

Sign In for Pricing
View Details
Anti-TSHR (K1-70) mAb
TA421262 100 µg

Anti-TSHR (K1-70) mAb

Sign In for Pricing
View Details