Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-Conjugating Enzyme E2 T/UBE2T (N-6His)

Source: E.coli. MW :24.7kD. Recombinant Human Ubiquitin-Conjugating Enzyme E2 T is produced by our E.coli expression system and the target gene encoding Met1-Val197 is expressed with a 6His tag at the N-terminus. Ubiquitin-Conjugating Enzyme E2 T (UBE2T) is a ligase that belongs to the Ubiquitin-Conjugating Enzyme family. UBE2T accepts the ATP-dependent ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, UBE2T is able to catalyze polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11'-, 'Lys-27'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination. UBE2T is an important factor of the Faconi anemia pathway of DNA damage repair and, upon self-inactivation, may negatively regulate the Faconi pathway.

Product Specifications

Gene Name

UBE2T

Gene ID

29089

UniProt

Q9NPD8

Components

Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Mrpl38 shRNA (UAS) - Lentiviral mouseMrpl38 shRNA (UAS, GFP) (25)
GTR15203252 1 Vial

Lentiviral mouse Mrpl38 shRNA (UAS) - Lentiviral mouseMrpl38 shRNA (UAS, GFP) (25)

Ask
View Details
Human E Cadherin ELISA Kit
MBS732317-01 48 Strip Well (Competitive)

Human E Cadherin ELISA Kit

Ask
View Details
Human E Cadherin ELISA Kit
MBS732317-02 48 Strip Well (Sandwich)

Human E Cadherin ELISA Kit

Ask
View Details
Human E Cadherin ELISA Kit
MBS732317-03 96 Strip Well (Competitive)

Human E Cadherin ELISA Kit

Ask
View Details
Human E Cadherin ELISA Kit
MBS732317-04 96 Strip Well (Sandwich)

Human E Cadherin ELISA Kit

Ask
View Details
Human E Cadherin ELISA Kit
MBS732317-05 5x 96 Strip Well (Competitive)

Human E Cadherin ELISA Kit

Ask
View Details