Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-Conjugating Enzyme E2 T/UBE2T (N-6His)

Source: E.coli. MW :24.7kD. Recombinant Human Ubiquitin-Conjugating Enzyme E2 T is produced by our E.coli expression system and the target gene encoding Met1-Val197 is expressed with a 6His tag at the N-terminus. Ubiquitin-Conjugating Enzyme E2 T (UBE2T) is a ligase that belongs to the Ubiquitin-Conjugating Enzyme family. UBE2T accepts the ATP-dependent ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, UBE2T is able to catalyze polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11'-, 'Lys-27'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination. UBE2T is an important factor of the Faconi anemia pathway of DNA damage repair and, upon self-inactivation, may negatively regulate the Faconi pathway.

Product Specifications

Gene Name

UBE2T

Gene ID

29089

UniProt

Q9NPD8

Components

Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R3C (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 3C, PPP1R5) (PE)
250400-PE 100 µL

PPP1R3C (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 3C, PPP1R5) (PE)

Sign In for Pricing
View Details
SOX2 Antibody
AF7950-01 50 µL

SOX2 Antibody

Sign In for Pricing
View Details
SOX2 Antibody
AF7950-02 100 µL

SOX2 Antibody

Sign In for Pricing
View Details
SOX2 Antibody
AF7950-03 200 µL

SOX2 Antibody

Sign In for Pricing
View Details
Parabolan
TRC-P191003-750MG 750 mg

Parabolan

Sign In for Pricing
View Details
H2-M3 CRISPR Activation Plasmid (m)
sc-420767-ACT 20 µg

H2-M3 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details