Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-Conjugating Enzyme E2 H/UBE2H (N-GST)

Source: E.coli. MW :47kD. Recombinant Human Ubiquitin-Conjugating Enzyme E2 H is produced by our E.coli expression system and the target gene encoding Met1-Leu183 is expressed with a GST tag at the N-terminus. Ubiquitin-Conjugating Enzyme E2 H (UBE2H) belongs to the E2 Ubiquitin-Conjugating Enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. It has been shown to conjugate ubiquitin to histone H2A in an E3 dependent manner in vitro. UBE2H is the human homolog to the yeast DNA repair gene RAD6, which is induced by DNA damaging reagents. UBE2H has been associated with cancer-induced cachexia and with the regulation of sepsis-induced muscle proteolysis.

Product Specifications

Gene Name

UBE2H

Gene ID

7328

UniProt

P62256

Components

Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human ALG8 shRNA (UAS) - Lentiviral human ALG8 shRNA (UAS, GFP) plasmid
GTR15086182 1 Vial

Lentiviral human ALG8 shRNA (UAS) - Lentiviral human ALG8 shRNA (UAS, GFP) plasmid

Ask
View Details
3- (4'-Carboxyphenyl) iMino-3H-phenothiazine
140222-07-7 1 Each

3- (4'-Carboxyphenyl) iMino-3H-phenothiazine

Ask
View Details
Kukoamine B Impurity 14
RM-K211114-01 10 mg

Kukoamine B Impurity 14

Ask
View Details
Kukoamine B Impurity 14
RM-K211114-02 25 mg

Kukoamine B Impurity 14

Ask
View Details
Kukoamine B Impurity 14
RM-K211114-03 50 mg

Kukoamine B Impurity 14

Ask
View Details
Kukoamine B Impurity 14
RM-K211114-04 100 mg

Kukoamine B Impurity 14

Ask
View Details