Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-Conjugating Enzyme E2 D4/UBE2D4 (N-GST)

Source: E.coli. MW :43.45kD. Recombinant Human Ubiquitin-Conjugating Enzyme E2 D4 is produced by our E.coli expression system and the target gene encoding Met1-Met147 is expressed with a GST tag at the N-terminus. Ubiquitin-Conjugating Enzyme E2 D4 (UBE2D4) is a ligase that belongs to the Ubiquitin-Conjugating Enzyme family. UBE2D4 has been proposed to participate in Ubl conjugation pathway. UBE2D4 takes part in post-translational protein modification, protein K6-linked ubiquitination, protein K11-linked ubiquitination, protein K27-linked ubiquitination, protein K29-linked ubiquitination, protein K48-linked ubiquitination, and protein K63-linked ubiquitination. UBE2D4 regulate of protein metabolic process. UBE2D4 accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, UBE2D4 able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked poly-ubiquitination.

Product Specifications

Gene Name

UBE2D4

Gene ID

51619

UniProt

Q9Y2X8

Components

Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM
More Discoveries

Explore Other Products

Browse additional items from our catalog

TSSK5P1 CRISPRa sgRNA lentivector (set of three targets)(Human)
48650121 3x 1.0µg DNA

TSSK5P1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Canine interleukin 27 EBI3 (IL-27 EBI3) ELISA Kit
EIA06563Ca 1 Kit

Canine interleukin 27 EBI3 (IL-27 EBI3) ELISA Kit

Sign In for Pricing
View Details
ACE Antibody
GWB-62A40E 0.5 mL

ACE Antibody

Sign In for Pricing
View Details
Mouse Pcgf2 Pre-designed siRNA Set B
SI110221B 1 Each

Mouse Pcgf2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Apex Granulated Agar, 2kg
20-249 2 Kg/Unit

Apex Granulated Agar, 2kg

Sign In for Pricing
View Details
Klra21 (BC064073) Mouse Tagged ORF Clone
MR201532 10 µg

Klra21 (BC064073) Mouse Tagged ORF Clone

Sign In for Pricing
View Details