What is the catalog number for Recombinant Human Tumor Necrosis Factor beta/TNF beta?

The catalog number for Recombinant Human Tumor Necrosis Factor beta/TNF beta is 32-7159-10.

What sizes are available for Recombinant Human Tumor Necrosis Factor beta/TNF beta?

Recombinant Human Tumor Necrosis Factor beta/TNF beta is available in the following size(s): 10 µg.

Recombinant Human Tumor Necrosis Factor beta/TNF beta

Q: Is Recombinant Human Tumor Necrosis Factor beta/TNF beta in stock?

Recombinant Human Tumor Necrosis Factor beta/TNF beta is currently made to order / not held in immediate stock. Contact us for lead time.

Source: E.coli. MW :18.8kD. Recombinant Human Tumor Necrosis Factor beta is produced by our E.coli expression system and the target gene encoding Leu35-Leu205 is expressed. Tumor Necrosis Factor beta (TNF- beta) is a secreted protein belonging to the tumor necrosis factor family. TNF- beta binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM in homotrimeric form, binds to TNFRSF3/LTBR in heterotrimeric form with LTB. TNF- beta forms heterotrimers with lymphotoxin-beta, which anchors TNF- beta to the cell surface. TNF- beta mediates the inflammatory, immunostimulatory, and antiviral response, involves in the formation of second lymphoid organs during development, has a role in apoptosis. TNF- beta is produced by lymphocytes and cytotoxic for a variety of tumor cells in vitro and in vivo.

Product Specifications

Gene Name

LTA

Gene ID

4049

UniProt

P01374

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : The ED50 for this effect is typically 23 pg/mL.

Amino Acids

MLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL