Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Microtubule-Associated Protein Tau/MAPT-D/Tau-D (C-6His)

Source: E.coli. MW :15.37kD. Recombinant Human Microtubule-Associated Protein Tau-D is produced by our E.coli expression system and the target gene encoding Gln249-Gln381 is expressed with a 6His tag at the C-terminus. Microtubule-Associated Protein TAU is abundantly expressed in neurons of the central nervous system and less commonly expressed elsewhere, but is also expressed at very low levels in CNS astrocytes and oligodendrocytes. Tau interacts with tubulin to stabilize microtubules and promotes tubulin assembly into microtubules. The C-terminus of TAU binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau acts as a linker protein. When tau is defective, and no longer stabilize microtubules properly, it can result in dementias such as Alzheimer's disease and other tauopathies.

Product Specifications

Gene Name

MAPT

Gene ID

4137

UniProt

P10636

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQLEHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

EDG2, NT (LPAR1, EDG2, LPA1, Lysophosphatidic acid receptor 1, Lysophosphatidic acid receptor Edg-2) (Biotin) discontinued
034915-Biotin 200 µL

EDG2, NT (LPAR1, EDG2, LPA1, Lysophosphatidic acid receptor 1, Lysophosphatidic acid receptor Edg-2) (Biotin) discontinued

Ask
View Details
Human Citrate synthase, mitochondrial, CS ELISA Kit
MBS1605984-01 48 Well

Human Citrate synthase, mitochondrial, CS ELISA Kit

Ask
View Details
Human Citrate synthase, mitochondrial, CS ELISA Kit
MBS1605984-02 96 Well

Human Citrate synthase, mitochondrial, CS ELISA Kit

Ask
View Details
Human Citrate synthase, mitochondrial, CS ELISA Kit
MBS1605984-03 5x 96 Well

Human Citrate synthase, mitochondrial, CS ELISA Kit

Ask
View Details
Human Citrate synthase, mitochondrial, CS ELISA Kit
MBS1605984-04 10x 96 Well

Human Citrate synthase, mitochondrial, CS ELISA Kit

Ask
View Details
Weinreb Linker extrapure, 98%
76374 1 g

Weinreb Linker extrapure, 98%

Ask
View Details