Recombinant Human Microtubule-Associated Protein Tau/MAPT-D/Tau-D (C-6His)
Source: E.coli. MW :15.37kD. Recombinant Human Microtubule-Associated Protein Tau-D is produced by our E.coli expression system and the target gene encoding Gln249-Gln381 is expressed with a 6His tag at the C-terminus. Microtubule-Associated Protein TAU is abundantly expressed in neurons of the central nervous system and less commonly expressed elsewhere, but is also expressed at very low levels in CNS astrocytes and oligodendrocytes. Tau interacts with tubulin to stabilize microtubules and promotes tubulin assembly into microtubules. The C-terminus of TAU binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau acts as a linker protein. When tau is defective, and no longer stabilize microtubules properly, it can result in dementias such as Alzheimer's disease and other tauopathies.
Product Specifications
Gene Name
MAPT
Gene ID
4137
UniProt
P10636
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQLEHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items