Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small Ubiquitin-Related Modifier 2/SUMO2 (N-6His)

Source: E.coli. MW :13kD. Recombinant Human SUMO2 is produced by our E.coli expression system and the target gene encoding Met1-Gly93 is expressed with a 6His tag at the N-terminus. Small Ubiquitin-Related Modifier 2 (SUMO2) is an Ubiquitin-like protein that belongs to the ubiquitin family with SUMO subfamily. It is a family of small, related proteins that can be enzymatically attached to a target protein by a post-translational modification process termed sumoylation. SUMO2 can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptidebond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins.

Product Specifications

Gene Name

SUMO2

Gene ID

6613

UniProt

P61956

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD29 (Integrin beta 1) (APC) discontinued
C2381-10B-APC 100 µL

CD29 (Integrin beta 1) (APC) discontinued

Sign In for Pricing
View Details
LIM2, CT (LIM2, Lens fiber membrane intrinsic protein, MP18, MP19, MP20) (Azide free) (HRP)
MBS6316101-01 0.2 mL

LIM2, CT (LIM2, Lens fiber membrane intrinsic protein, MP18, MP19, MP20) (Azide free) (HRP)

Sign In for Pricing
View Details
LIM2, CT (LIM2, Lens fiber membrane intrinsic protein, MP18, MP19, MP20) (Azide free) (HRP)
MBS6316101-02 5x 0.2 mL

LIM2, CT (LIM2, Lens fiber membrane intrinsic protein, MP18, MP19, MP20) (Azide free) (HRP)

Sign In for Pricing
View Details
CDCP1, CT (CDCP1, TRASK, CUB domain-containing protein 1, Membrane glycoprotein gp140, Subtractive immunization M plus HEp3-associated 135kD protein, Transmembrane and associated with src kinases, CD318) (MaxLight 750)
MBS6284059-01 0.1 mL

CDCP1, CT (CDCP1, TRASK, CUB domain-containing protein 1, Membrane glycoprotein gp140, Subtractive immunization M plus HEp3-associated 135kD protein, Transmembrane and associated with src kinases, CD318) (MaxLight 750)

Sign In for Pricing
View Details
CDCP1, CT (CDCP1, TRASK, CUB domain-containing protein 1, Membrane glycoprotein gp140, Subtractive immunization M plus HEp3-associated 135kD protein, Transmembrane and associated with src kinases, CD318) (MaxLight 750)
MBS6284059-02 5x 0.1 mL

CDCP1, CT (CDCP1, TRASK, CUB domain-containing protein 1, Membrane glycoprotein gp140, Subtractive immunization M plus HEp3-associated 135kD protein, Transmembrane and associated with src kinases, CD318) (MaxLight 750)

Sign In for Pricing
View Details
Ppp1r14c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3741306 1.0 µg DNA

Ppp1r14c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details