Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small Ubiquitin-Related Modifier 2/SUMO2 (N-6His)

Source: E.coli. MW :13kD. Recombinant Human SUMO2 is produced by our E.coli expression system and the target gene encoding Met1-Gly93 is expressed with a 6His tag at the N-terminus. Small Ubiquitin-Related Modifier 2 (SUMO2) is an Ubiquitin-like protein that belongs to the ubiquitin family with SUMO subfamily. It is a family of small, related proteins that can be enzymatically attached to a target protein by a post-translational modification process termed sumoylation. SUMO2 can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptidebond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins.

Product Specifications

Gene Name

SUMO2

Gene ID

6613

UniProt

P61956

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Caspase-13 Antibody
2245 100ug

Anti-Caspase-13 Antibody

Ask
View Details
Rat Lrp11 Pre-designed siRNA Set A
SI207778A 1 Each

Rat Lrp11 Pre-designed siRNA Set A

Ask
View Details
Mouse Monoclonal Legionella Pneumophila Lps Antibody (5F4) [DyLight 550]
NB100-73187R 0.2 mL

Mouse Monoclonal Legionella Pneumophila Lps Antibody (5F4) [DyLight 550]

Ask
View Details
SLC25A34 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
44018066 1.0 µg DNA

SLC25A34 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Ask
View Details
β-defensin 4 shRNA (h) Lentiviral Particles
sc-77877-V 200 µL

β-defensin 4 shRNA (h) Lentiviral Particles

Ask
View Details
Human GLI1 (GLI Family Zinc Finger Protein 1) ELISA Kit
MBS8803290-01 48 Well

Human GLI1 (GLI Family Zinc Finger Protein 1) ELISA Kit

Ask
View Details