Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small Ubiquitin-Related Modifier 1/SUMO1 (N-6His)

Source: E.coli. MW :13.7kD. Recombinant Human SUMO1 is produced by our E.coli expression system and the target gene encoding Met1-Val101 is expressed with a 6His tag at the N-terminus. Small Ubiquitin-Related Modifier 1 (SUMO1) is an Ubiquitin-like protein that belongs to the ubiquitin family with SUMO subfamily. It is a family of small, related proteins that can be enzymatically attached to a target protein by a post-translational modification process termed sumoylation. SUMO1 functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. SUMO1 is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. SUMO1 is not active until the last four amino acids of the carboxy-terminus are cleaved off. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins and may also regulate a network of genes involved in palate development.

Product Specifications

Gene Name

SUMO1

Gene ID

7341

UniProt

P63165

Components

Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl, 100mM NaCl, 1mM DTT, pH 8.5 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNNTPKELGMEEEDVIEVYQEQTGGHSTV

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHS2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1300005 3x 1.0 µg

MHS2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RPSAP48 3'UTR Luciferase Stable Cell Line
TU022357 1.0 mL

RPSAP48 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Snx16 (NM_029068) Mouse Recombinant Protein
PM47085M5 20 µg

Snx16 (NM_029068) Mouse Recombinant Protein

Sign In for Pricing
View Details
TRAPPC2 Protein Vector (Rat) (pPB-C-His)
PV312734 500 ng

TRAPPC2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
7-Hydroxyguanine
HY-N15034 1 Each

7-Hydroxyguanine

Sign In for Pricing
View Details
Mrpl15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4588605 3x 1.0 µg

Mrpl15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details