Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small Ubiquitin-Related Modifier 1/SUMO1 (N-6His)

Source: E.coli. MW :13.7kD. Recombinant Human SUMO1 is produced by our E.coli expression system and the target gene encoding Met1-Val101 is expressed with a 6His tag at the N-terminus. Small Ubiquitin-Related Modifier 1 (SUMO1) is an Ubiquitin-like protein that belongs to the ubiquitin family with SUMO subfamily. It is a family of small, related proteins that can be enzymatically attached to a target protein by a post-translational modification process termed sumoylation. SUMO1 functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. SUMO1 is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. SUMO1 is not active until the last four amino acids of the carboxy-terminus are cleaved off. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins and may also regulate a network of genes involved in palate development.

Product Specifications

Gene Name

SUMO1

Gene ID

7341

UniProt

P63165

Components

Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl, 100mM NaCl, 1mM DTT, pH 8.5 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNNTPKELGMEEEDVIEVYQEQTGGHSTV

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Serine/Arginine Rich Splicing Factor 4 (SRSF4) ELISA Kit
abx154709-01 96 Tests

Mouse Serine/Arginine Rich Splicing Factor 4 (SRSF4) ELISA Kit

Ask
View Details
Mouse Serine/Arginine Rich Splicing Factor 4 (SRSF4) ELISA Kit
abx154709-02 5x 96 Tests

Mouse Serine/Arginine Rich Splicing Factor 4 (SRSF4) ELISA Kit

Ask
View Details
Mouse Serine/Arginine Rich Splicing Factor 4 (SRSF4) ELISA Kit
abx154709-03 10x 96 Tests

Mouse Serine/Arginine Rich Splicing Factor 4 (SRSF4) ELISA Kit

Ask
View Details
RNF103 siRNA (m)
sc-106517 10 µM

RNF103 siRNA (m)

Ask
View Details
Human AP-4 complex subunit epsilon-1 (AP4E1) ELISA Kit
abx502059 96 Tests

Human AP-4 complex subunit epsilon-1 (AP4E1) ELISA Kit

Ask
View Details
Rat Histone H2B Type 1-B (HIST1H2BB) ELISA Kit
MBS9922608-01 48 Well

Rat Histone H2B Type 1-B (HIST1H2BB) ELISA Kit

Ask
View Details