Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stathmin/STMN1 (C-6His)

Source: E.coli. MW :18.37kD. Recombinant Human Stathmin is produced by our E.coli expression system and the target gene encoding Ala2-Asp149 is expressed with a 6His tag at the C-terminus. Stathmin (STMN1) is a ubiquitous cytosolic phosphoprotein which belongs to the Stathmin family. STMN1 is expressed in many tissues, with the highest expression in the brain, spinal cord, and cerebellum. It can also be expressed in the colon, ovary, placenta, uterus, and trachea. STMN1 participates in the regulation of the microtubule filament structure by destabilizing microtubules. STMN1 promotes the disassembly of microtubules and prevents assembly. STMN1 is involved in the control of the learned and innate fear. STMN1 is an intracellular relay integrating regulatory signals of the cellular environment and as an Oncoprotein in regulation of the cell cycle. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Mutation in STMN1 effects cell homeostasis that may lead to tumorigenicity.

Product Specifications

Gene Name

STMN1

Gene ID

3925

UniProt

P16949

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEADLEHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 S-trimer Protein (His Tag)
PKSR030489-01 50 µg

Recombinant SARS-CoV-2 S-trimer Protein (His Tag)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S-trimer Protein (His Tag)
PKSR030489-02 1 mg

Recombinant SARS-CoV-2 S-trimer Protein (His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Ureter
CS805827 5x 5 µm

Tissue FFPE Sections, Ureter

Sign In for Pricing
View Details
Integrin beta 1 Recombinant Rabbit Monoclonal Antibody [SA40-08]
ET1601-17 100 µL

Integrin beta 1 Recombinant Rabbit Monoclonal Antibody [SA40-08]

Sign In for Pricing
View Details
Ly86 (NM_010745) Mouse Tagged ORF Clone
MG201281 10 µg

Ly86 (NM_010745) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rpl12 (BC090393) Mouse Tagged ORF Clone
MG201340 10 µg

Rpl12 (BC090393) Mouse Tagged ORF Clone

Sign In for Pricing
View Details