Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sentrin-Specific Protease 8/SENP8 (N-6His)

Source: E.coli. MW :26.24kD. Recombinant Human Sentrin-Specific Protease 8 is produced by our E.coli expression system and the target gene encoding Met1-Lys212 is expressed with a 6His tag at the N-terminus. Sentrin-Specific Protease 8 (SENP8) mediates the reversible covalent modification of proteins by NEDD8. SENP8 catalyzes the full-length NEDD8 to generate its mature form and deconjugation of NEDD8 from targeted proteins such as CUL2 , CUL4A in vivo, or p53. but it does not show activity against ubiquitin or SUMO proteins.

Product Specifications

Gene Name

SENP8

Gene ID

123228

UniProt

Q96LD8

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PPAR alpha (PPARA) Mouse Monoclonal Antibody [Clone ID: OTI2G6]
TA503545 100 µL

PPAR alpha (PPARA) Mouse Monoclonal Antibody [Clone ID: OTI2G6]

Ask
View Details
Anti-RAB14 antibody
STJ193089 200 µl

Anti-RAB14 antibody

Ask
View Details
Josephin 1 (JOSD1) CytoSection
TS401968P5 25 Slides

Josephin 1 (JOSD1) CytoSection

Ask
View Details
PAICS (6V6) Mouse Monoclonal antibody
E28PE3024 100 µL

PAICS (6V6) Mouse Monoclonal antibody

Ask
View Details
Mouse Monoclonal ICAM-1/CD54 Antibody (1H4) [Alexa Fluor 750]
NB110-58732AF750 0.1 mL

Mouse Monoclonal ICAM-1/CD54 Antibody (1H4) [Alexa Fluor 750]

Ask
View Details