Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sentrin-Specific Protease 8/SENP8 (N-6His)

Source: E.coli. MW :26.24kD. Recombinant Human Sentrin-Specific Protease 8 is produced by our E.coli expression system and the target gene encoding Met1-Lys212 is expressed with a 6His tag at the N-terminus. Sentrin-Specific Protease 8 (SENP8) mediates the reversible covalent modification of proteins by NEDD8. SENP8 catalyzes the full-length NEDD8 to generate its mature form and deconjugation of NEDD8 from targeted proteins such as CUL2 , CUL4A in vivo, or p53. but it does not show activity against ubiquitin or SUMO proteins.

Product Specifications

Gene Name

SENP8

Gene ID

123228

UniProt

Q96LD8

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PYK2 antibody
20R-2925 100 ul

PYK2 antibody

Ask
View Details
Troponin T (Cardiac)
GWB-B1FF51 0.1 mg

Troponin T (Cardiac)

Ask
View Details
C1orf144, NT (C1orf144, UPF0485 protein C1orf144, Putative MAPK-activating protein PM18/PM20/PM22) (APC) discontinued
032826-APC 200 µL

C1orf144, NT (C1orf144, UPF0485 protein C1orf144, Putative MAPK-activating protein PM18/PM20/PM22) (APC) discontinued

Ask
View Details
Phosphate Buffered RIPA
41620005-4 1 L

Phosphate Buffered RIPA

Ask
View Details
Recombinant Bacillus halodurans HTH-type transcriptional regulator NsrR (nsrR)
MBS1423165-01 0.02 mg (E-Coli)

Recombinant Bacillus halodurans HTH-type transcriptional regulator NsrR (nsrR)

Ask
View Details
Recombinant Bacillus halodurans HTH-type transcriptional regulator NsrR (nsrR)
MBS1423165-02 0.1 mg (E-Coli)

Recombinant Bacillus halodurans HTH-type transcriptional regulator NsrR (nsrR)

Ask
View Details