Recombinant Human Retinol-Binding Protein 4/RBP4

Source: E.coli. MW :21.2kD. Recombinant Human Retinol-Binding Protein 4 is produced by our E.coli expression system and the target gene encoding Glu19-Leu201 is expressed. Retinol Binding Protein 4 (RBP4) is a member of the Lipocalin family and in the blood. RBP4 is the specific vector for retinol. RBP4 is expressed and secreted by adipose tissue, and is associated with insulin resistance. RBP4 delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin to prevents its loss by filtration through the kidney glomeruli. Defects in RBP4 cause retinol-binding protein deficiency and can cause night vision problems.

Product Specifications

Gene Name

RBP4

Gene ID

5950

UniProt

P02753

Components

Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl, 10mM CaCl2, 150mM NaCl, pH 7.5 .

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL