Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phosphoserine Phosphatase/PSP (C-6His)

Source: E.coli. MW :26.07kD. Recombinant Human Phosphoserine Phosphatase is produced by our E.coli expression system and the target gene encoding Met1-Glu225 is expressed with a 6His tag at the C-terminus. Phosphoserine phosphatase (PSP) is an enzyme that belongs to the serB family. PSPH catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates. Deficiency of this protein is thought to be linked to Williams syndrome. A disorder that results in pre- and postnatal growth retardation, moderate psychomotor retardation and facial features suggestive of Williams syndrome.

Product Specifications

Gene Name

PSPH

Gene ID

5723

UniProt

P78330

Components

Supplied as a 0.2 μm filtered solution of 50mM Tris, 250mM NaCl, 50mM Imidazole, pH 8.5 .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEELEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IL-3 Protein, Mouse, Recombinant (C-hFc)
E51P00422 100 µg

IL-3 Protein, Mouse, Recombinant (C-hFc)

Ask
View Details
5-Propargylamino-CTP – ATTO-Rho13
JBS-NU-831-RHO13 40 µL

5-Propargylamino-CTP – ATTO-Rho13

Ask
View Details
Fetuin beta Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-9908R-PerCP-Cy5.5 100 µL

Fetuin beta Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Ask
View Details
pmCherry-N1-ARPC1B Plasmid
PVT23850 2 µg

pmCherry-N1-ARPC1B Plasmid

Ask
View Details
Tceal6 Mouse qPCR Primer Pair (NM_025355)
MP217105 200 Reactions

Tceal6 Mouse qPCR Primer Pair (NM_025355)

Ask
View Details
Nylon, Pore Size 0.45 μm, 13 mm Dia, Sterile, Blister Package, 100 pcs/pack, 1 pack/case, 100 pcs/case
331221 100 PCS/CS

Nylon, Pore Size 0.45 μm, 13 mm Dia, Sterile, Blister Package, 100 pcs/pack, 1 pack/case, 100 pcs/case

Ask
View Details