Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein Kinase C Type e/PKC e/PKCE (C-6His)

Source: E.coli. MW :19.64kD. Recombinant Human PKC epsilon is produced by our E.coli expression system and the target gene encoding Gln580-Pro737 is expressed with a 6His tag at the C-terminus. Protein Kinase C Epsilon type is a member of the serine- and threonine-specific protein kinase family that can be activated by calcium and the second messenger diacylglycerol. Protein Kinase C Epsilon contains these domains: one AGC-kinase C-terminal domain, one C2 domain, one protein kinase domain and two phorbol-ester/DAG-type zinc fingers. Protein Kinase C Epsilon phosphorylate a variety of protein targets and has been identified to participate in diverse cellular signaling pathways. It has many different cellular functions, such as neuron channel activation, apoptosis, cardioprotection from ischemia, heat shock response, as well as insulin exocytosis. Protein Kinase C Epsilon also serves as the receptor for phorbol esters, a class of tumor promoters.

Product Specifications

Gene Name

PRKCE

Gene ID

5581

UniProt

Q02156

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMPLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Olfr1118 activation kit by CRISPRa
GA217406 1 Kit

Mouse Olfr1118 activation kit by CRISPRa

Ask
View Details
Anti-Phospho-PI3K p85 alpha/PIK3R1 (T458) /PI3K p55 Gamma/PIK3R3 (Y199) Antibody
P00318-1 100 µL

Anti-Phospho-PI3K p85 alpha/PIK3R1 (T458) /PI3K p55 Gamma/PIK3R3 (Y199) Antibody

Ask
View Details
SIDT1 (SID1 Transmembrane Family Member 1)
491711 100 µL

SIDT1 (SID1 Transmembrane Family Member 1)

Ask
View Details
Catenin delta-1
MBS9247947-01 0.05 mL

Catenin delta-1

Ask
View Details
Catenin delta-1
MBS9247947-02 0.2 mL

Catenin delta-1

Ask
View Details
Catenin delta-1
MBS9247947-03 5x 0.2 mL

Catenin delta-1

Ask
View Details