Recombinant Human Parvalbumin a/PVALB (C-6His)
Source: E.coli. MW :13.12kD. Recombinant Human Parvalbumin alpha is produced by our E.coli expression system and the target gene encoding Ser2-Ser110 is expressed with a 6His tag at the C-terminus. Parvalbumin a (PVALB) is a member of the parvalbumin family. PVALB is a high affinity calcium ion-binding protein, with two EF hand domains. PVALB is structurally and functionally similar to calmodulin and troponin C, it can bind two calcium ions. Parvalbumin is thought to be involved in relaxation after contraction in muscle. Parvalbumin is expressed in a specific population of GABAergic interneurons, which are believed to have a role in maintaining the balance between excitation and inhibition in the cortex as well as the hippocampus.
Product Specifications
Gene Name
PVALB
Gene ID
5816
UniProt
P20472
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAESLEHHHHHH
Explore Other Products
Browse additional items from our catalog