Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-20/IL-20

Source: E.coli. MW :20.07kD. Recombinant Human Interleukin-20 is produced by our E.coli expression system and the target gene encoding Leu25-Glu176 is expressed. Interleukin-20 (IL-20) is a member of the IL-10 family of regulatory cytokines that includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. IL-20 exhibits approximately 28% amino acid identity with IL-10 and 76% amino acid identity with mouse IL-20. There are two heterodimeric receptor complexes for IL-20. The first is composed of IL-20 Ra and IL-20 R beta. The second is composed of IL-22 R and IL-20 R beta. Whereas the IL-22 R/IL-20 R beta complex is shared with IL-24, the IL-20 Ra/IL-20 R beta complex is shared with both IL-19 and IL-24. IL-20 has been shown to initiate transduction cascades involving STAT3 and stimulates the induction of pro-inflammatory genes including TNF-a and MCP-1. Initial functional studies using transgenic mice suggest that IL-20 has the ability to regulate skin development. The over-expression of both human and mouse forms of IL-20 results in keratinocyte hyper-proliferation, abnormal epidermal differentiation, and neonatal lethality. In humans, IL-20 and its receptors are up-regulated in psoriatic skin, and polymorphisms in the IL-20 gene have been associated with plaque-type psoriasis. IL-20 may also have a role in hematopoiesis. It enhances the proliferation of multi-potential progenitors in vitro and increases their numbers and cell cycling status in IL-20 transgenic mice. IL-20 is also shown to suppress COX-2 and PGE2 and acts as an inhibitor of angiogenesis in model systems.

Product Specifications

Gene Name

IL20

Gene ID

50604

UniProt

Q9NYY1

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

R-Ras (Phospho-Tyr66) rabbit pAb
RA36904-01 50 µL

R-Ras (Phospho-Tyr66) rabbit pAb

Ask
View Details
R-Ras (Phospho-Tyr66) rabbit pAb
RA36904-02 100 µL

R-Ras (Phospho-Tyr66) rabbit pAb

Ask
View Details
Rabbit Polyclonal TMEM214 Antibody [Biotin]
NBP2-82033B 0.1 mL

Rabbit Polyclonal TMEM214 Antibody [Biotin]

Ask
View Details
Mouse Anti-Double Stranded DNA Antibody (Anti-dsDNA) ELISA KIT
EIA05581m 1 Kit

Mouse Anti-Double Stranded DNA Antibody (Anti-dsDNA) ELISA KIT

Ask
View Details
JMY (Junction-mediating and -regulatory Protein, FLJ37870, MGC163496, WHDC1L3) (MaxLight 490)
MBS6201479-01 0.1 mL

JMY (Junction-mediating and -regulatory Protein, FLJ37870, MGC163496, WHDC1L3) (MaxLight 490)

Ask
View Details
JMY (Junction-mediating and -regulatory Protein, FLJ37870, MGC163496, WHDC1L3) (MaxLight 490)
MBS6201479-02 5x 0.1 mL

JMY (Junction-mediating and -regulatory Protein, FLJ37870, MGC163496, WHDC1L3) (MaxLight 490)

Ask
View Details