Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heme Oxygenase 1/HO-1

Source: E.coli. MW :29.86kD. Recombinant Human Heme Oxygenase 1 is produced by our E.coli expression system and the target gene encoding Met1-Thr261 is expressed. Heme Oxygenase 1 (HO-1) is an enzyme in endoplasmic reticulum that belongs to the heme oxygenase family. HO-1 cleaves the heme ring at the alpha methene bridge to form Biliverdin. Biliverdin is subsequently converted to Bilirubin by Biliverdin reductase. In physiological state, the highest activity of HO-1 is found in the spleen, where senescent erythrocytes are sequestrated and destroyed. HO-1 activity is highly inducible by its substrate heme and by various non-heme substances such as heavy metals, bromobenzene, endotoxin, oxidizing agents and UVA. HO-1 is involved in the regulation of cardiovascular function and response to a variety of stressors. Defects in HO-1 are the cause of Heme Oxygenase 1 deficiency, resulting in marked erythrocyte fragmentation and intravascular hemolysis, coagulation abnormalities, endothelial damage, and iron deposition in renal and hepatic tissues.

Product Specifications

Gene Name

HMOX1

Gene ID

3162

UniProt

P09601

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNT
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Oclacitinib Impurity 15
RM-O010015-01 10 mg

Oclacitinib Impurity 15

Ask
View Details
Oclacitinib Impurity 15
RM-O010015-02 25 mg

Oclacitinib Impurity 15

Ask
View Details
Oclacitinib Impurity 15
RM-O010015-03 50 mg

Oclacitinib Impurity 15

Ask
View Details
Oclacitinib Impurity 15
RM-O010015-04 100 mg

Oclacitinib Impurity 15

Ask
View Details
GRIP1 (Glucocorticoid Receptor Interacting Protein 1, GRIP-1, BHLHE75, KAT13C, MGC138808, Nuclear Receptor Coactivator 2, NCoA2, NCoA-2, Steroid Receptor Coactivator 2, SRC-2, src2, Transcriptional Intermediary Factor 2, TIF2) (AP) discontinued
G8970-03G-AP 100 µL

GRIP1 (Glucocorticoid Receptor Interacting Protein 1, GRIP-1, BHLHE75, KAT13C, MGC138808, Nuclear Receptor Coactivator 2, NCoA2, NCoA-2, Steroid Receptor Coactivator 2, SRC-2, src2, Transcriptional Intermediary Factor 2, TIF2) (AP) discontinued

Ask
View Details
Sun3 (NM_001290519) Mouse Tagged ORF Clone
MR229229 10 µg

Sun3 (NM_001290519) Mouse Tagged ORF Clone

Ask
View Details