Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GABA (A) Receptor-Associated Protein/GABARAP (N-GST)

Source: E.coli. MW :40.21kD. Recombinant Human GABARAP is produced by our E.coli expression system and the target gene encoding Met1-Lys117 is expressed with a GST tag at the N-terminus. Gamma-Aminobutyric Acid Receptor-Associated Protein (GABARAP) is a ligand-gated chloride channel protein that mediates inhibitory neurotransmission and belongs to the MAP1 LC3 family. GABARAP is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. GABARAP clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. Autophagy is the process by which cells recycle cytoplasm and dispose of excess or defective organelles. This process is suggested to be involved development, differentiation, growth regulation and tissue remodeling in multicellular organisms. An important inhibitory neurotransmitter, GABA, acts on GABA receptors that are ubiquitously expressed in the CNS. GABARAP has been shown to play a important role in intracellular transport of GABA (A) receptors and its interaction with the cytoskeleton.

Product Specifications

Gene Name

GABARAP

Gene ID

11337

UniProt

Q6IAW1

Components

Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl, 200mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Dog GLPA ELISA Kit
E103030 1 Each

Dog GLPA ELISA Kit

Ask
View Details
Igfbp5 Mouse Pre-designed siRNA Set A
HY-RS17010 1 Set

Igfbp5 Mouse Pre-designed siRNA Set A

Ask
View Details
Artemis (DCLRE1C, Protein Artemis, DNA Cross-link Repair 1C, Protein A-SCID, SNM1 Homolog C, hSNM1C, SNM1-like Protein, ASCID, SCIDA, SNM1C, FLJ11360, FLJ36438) APC
MBS6370420-01 0.1 mL

Artemis (DCLRE1C, Protein Artemis, DNA Cross-link Repair 1C, Protein A-SCID, SNM1 Homolog C, hSNM1C, SNM1-like Protein, ASCID, SCIDA, SNM1C, FLJ11360, FLJ36438) APC

Ask
View Details
Artemis (DCLRE1C, Protein Artemis, DNA Cross-link Repair 1C, Protein A-SCID, SNM1 Homolog C, hSNM1C, SNM1-like Protein, ASCID, SCIDA, SNM1C, FLJ11360, FLJ36438) APC
MBS6370420-02 5x 0.1 mL

Artemis (DCLRE1C, Protein Artemis, DNA Cross-link Repair 1C, Protein A-SCID, SNM1 Homolog C, hSNM1C, SNM1-like Protein, ASCID, SCIDA, SNM1C, FLJ11360, FLJ36438) APC

Ask
View Details
CD44 Mouse Monoclonal Antibody [Clone ID: OX-49]
CL110FX 500 µg

CD44 Mouse Monoclonal Antibody [Clone ID: OX-49]

Ask
View Details
GCAP1, CT (Guanylyl Cyclase-activating Protein 1, GCAP 1, Guanylate Cyclase Activator 1A, GUCA1A, C6orf131, GCAP, GCAP1, GUCA1) (MaxLight 750) discontinued
G9806-02A-ML750 100 µL

GCAP1, CT (Guanylyl Cyclase-activating Protein 1, GCAP 1, Guanylate Cyclase Activator 1A, GUCA1A, C6orf131, GCAP, GCAP1, GUCA1) (MaxLight 750) discontinued

Ask
View Details