Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fructose-1,6-Bisphosphatase 1/FBPase 1 (E. coli, C-6His)

Source: E.coli. MW :37.89kD. Recombinant Human FBPase 1 is produced by our E.coli expression system and the target gene encoding Ala2-Gln338 is expressed with a 6His tag at the C-terminus. Fructose-1,6-Bisphosphatase 1 (FBPase 1) is a member of the FBPase class 1 family. FBPase 1 is a gluconeogenesis regulatory protein, which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. FBPase 1 can assume an active R-state, or an inactive T-state. FBPase 1 deficiency is inherited as an autosomal recessive disorder mainly in the liver and causes life-threatening episodes of hypoglycemia and metabolic acidosis in newborn infants or young children. FBPase 1 coupled with phosphofructokinase (PFK) is involved in the metabolism of pancreatic islet cells.

Product Specifications

Gene Name

FBP1

Gene ID

2203

UniProt

P09467

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, 1mM DTT, 1mM EDTA, 20% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQVEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PRKCD (MAY1, MGC49908, PKCD, nPKC-delta, protein kinase C delta VIII)
588640 50 µg

PRKCD (MAY1, MGC49908, PKCD, nPKC-delta, protein kinase C delta VIII)

Ask
View Details
TMEM68 CRISPRa sgRNA lentivector (set of three targets)(Human)
47082121 3x 1.0µg DNA

TMEM68 CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
Spermine synthase Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62532R-BF405-01 20 µL

Spermine synthase Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Ask
View Details
Spermine synthase Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62532R-BF405-02 100 µL

Spermine synthase Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Ask
View Details
HIST1H2BC (Ab-5) Antibody
A24846-100UL 100 µL

HIST1H2BC (Ab-5) Antibody

Ask
View Details