Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fructose-1,6-Bisphosphatase 1/FBPase 1 (E. coli, C-6His)

Source: E.coli. MW :37.89kD. Recombinant Human FBPase 1 is produced by our E.coli expression system and the target gene encoding Ala2-Gln338 is expressed with a 6His tag at the C-terminus. Fructose-1,6-Bisphosphatase 1 (FBPase 1) is a member of the FBPase class 1 family. FBPase 1 is a gluconeogenesis regulatory protein, which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. FBPase 1 can assume an active R-state, or an inactive T-state. FBPase 1 deficiency is inherited as an autosomal recessive disorder mainly in the liver and causes life-threatening episodes of hypoglycemia and metabolic acidosis in newborn infants or young children. FBPase 1 coupled with phosphofructokinase (PFK) is involved in the metabolism of pancreatic islet cells.

Product Specifications

Gene Name

FBP1

Gene ID

2203

UniProt

P09467

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, 1mM DTT, 1mM EDTA, 20% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQVEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal INO80 Antibody [DyLight 488]
NBP1-78759G 0.1 mL

Rabbit Polyclonal INO80 Antibody [DyLight 488]

Ask
View Details
APC_Cy7-Linked Polyclonal Antibody to Peroxiredoxin 4 (PRDX4)
MBS2163819-01 0.1 mL

APC_Cy7-Linked Polyclonal Antibody to Peroxiredoxin 4 (PRDX4)

Ask
View Details
APC_Cy7-Linked Polyclonal Antibody to Peroxiredoxin 4 (PRDX4)
MBS2163819-02 0.2 mL

APC_Cy7-Linked Polyclonal Antibody to Peroxiredoxin 4 (PRDX4)

Ask
View Details
APC_Cy7-Linked Polyclonal Antibody to Peroxiredoxin 4 (PRDX4)
MBS2163819-03 0.5 mL

APC_Cy7-Linked Polyclonal Antibody to Peroxiredoxin 4 (PRDX4)

Ask
View Details
APC_Cy7-Linked Polyclonal Antibody to Peroxiredoxin 4 (PRDX4)
MBS2163819-04 1 mL

APC_Cy7-Linked Polyclonal Antibody to Peroxiredoxin 4 (PRDX4)

Ask
View Details
APC_Cy7-Linked Polyclonal Antibody to Peroxiredoxin 4 (PRDX4)
MBS2163819-05 5 mL

APC_Cy7-Linked Polyclonal Antibody to Peroxiredoxin 4 (PRDX4)

Ask
View Details