Recombinant Human Fatty Acid-Binding Protein 2/FABP2/I-FABP ((N, C-6His)

Source: E.coli. MW :18.44kD. Recombinant Human FABP2 is produced by our E.coli expression system and the target gene encoding Met1-Asp132 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. Fatty Acid-Binding Protein 2 (FABP2) is a cytoplasm protein that belongs to the Fatty-acid binding protein (FABP) family of calycin superfamily. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids. FABP2 is expressed in the small intestine and at much lower levels in the large intestine, the highest expression levels in the jejunum. FABP2 binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis and may also help maintain energy homeostasis by functioning as a lipid sensor.

Product Specifications

Gene Name

FABP2

Gene ID

2169

UniProt

P12104

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKDLEHHHHHH