Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty Acid-Binding Protein 1/FABP1/L-FABP (N-6His)

Source: E.coli. MW :16.37kD. Recombinant Human FABP1 is produced by our E.coli expression system and the target gene encoding Met1-Ile127 is expressed with a 6His tag at the N-terminus. Human Fatty Acid-Binding Protein 1 (FABP1) is a cytoplasm protein, which belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids. FABP1 forms a beta-barrel structure that accommodates hydrophobic ligands in its interior. FABP1 can bind free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm, so it can be involved in intracellular lipid transport.

Product Specifications

Gene Name

FABP1

Gene ID

2168

UniProt

P07148

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nicorandil Impurity 72
RM-N031901-01 10 mg

Nicorandil Impurity 72

Ask
View Details
Nicorandil Impurity 72
RM-N031901-02 25 mg

Nicorandil Impurity 72

Ask
View Details
Nicorandil Impurity 72
RM-N031901-03 50 mg

Nicorandil Impurity 72

Ask
View Details
Nicorandil Impurity 72
RM-N031901-04 100 mg

Nicorandil Impurity 72

Ask
View Details
LEFTY1 (Left-right Determination Factor 1, LEFTB, LEFTYB) (FITC)
MBS6175222-01 0.1 mL

LEFTY1 (Left-right Determination Factor 1, LEFTB, LEFTYB) (FITC)

Ask
View Details
LEFTY1 (Left-right Determination Factor 1, LEFTB, LEFTYB) (FITC)
MBS6175222-02 5x 0.1 mL

LEFTY1 (Left-right Determination Factor 1, LEFTB, LEFTYB) (FITC)

Ask
View Details