Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human beta-Defensin 4A

Source: E.coli. MW :4.33kD. Recombinant Human beta-Defensin 4A is produced by our E.coli expression system and the target gene encoding Gly24-Pro64 is expressed. beta-Defensin 4A is a membrane-active cationic peptide that functions in inflammation and innate immune responses. There are at least 30 beta-Defensins, which are distinguished from a-Defensins by the connectivity pattern of their three intermolecular disulfide bonds. Members of the Defensin family are highly similar in protein sequence. This gene encodes Defensin, DEFB4; , which has broad-spectrum antimicrobial activity and may play an important role in innate epithelial defense. They are highly expressed in skin and tonsils, and to a lesser extent in trachea, uterus, kidney, thymus, adenoid, pharynx and tongue. beta-Defensin 4A has low expression in salivary gland, bone marrow, colon, stomach, polyp and larynx. No expression in small intestine. The 45 amino acid mature human BD3 shares 38% and 33% amino acid sequence identity with mouse and rat BD3, respectively.

Product Specifications

Gene Name

DEFB4A

Gene ID

100289462

UniProt

O15263

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 130mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Enthd1 shRNA (UAS) - Lentiviral mouse Enthd1 shRNA (UAS, RFP) (100)
GTR15164664 1 Vial

Lentiviral mouse Enthd1 shRNA (UAS) - Lentiviral mouse Enthd1 shRNA (UAS, RFP) (100)

Ask
View Details
Hp Antibody, FITC conjugated
A46610-100UG 100 µg

Hp Antibody, FITC conjugated

Ask
View Details
Recombinant Xenopus laevis Reticulon-1-A (rtn1-a), partial
MBS7089869 Inquire

Recombinant Xenopus laevis Reticulon-1-A (rtn1-a), partial

Ask
View Details
PE/Dazzle™ 594 anti-mouse CD11c
GT02472 25 µg

PE/Dazzle™ 594 anti-mouse CD11c

Ask
View Details
Mouse Monoclonal MEF2D Antibody (OTI1E11) [Alexa Fluor 647]
NBP2-72631AF647 0.1 mL

Mouse Monoclonal MEF2D Antibody (OTI1E11) [Alexa Fluor 647]

Ask
View Details
NAA20 cDNA
552104 10 µg

NAA20 cDNA

Ask
View Details