Recombinant Human beta-Defensin 4A
Source: E.coli. MW :4.33kD. Recombinant Human beta-Defensin 4A is produced by our E.coli expression system and the target gene encoding Gly24-Pro64 is expressed. beta-Defensin 4A is a membrane-active cationic peptide that functions in inflammation and innate immune responses. There are at least 30 beta-Defensins, which are distinguished from a-Defensins by the connectivity pattern of their three intermolecular disulfide bonds. Members of the Defensin family are highly similar in protein sequence. This gene encodes Defensin, DEFB4; , which has broad-spectrum antimicrobial activity and may play an important role in innate epithelial defense. They are highly expressed in skin and tonsils, and to a lesser extent in trachea, uterus, kidney, thymus, adenoid, pharynx and tongue. beta-Defensin 4A has low expression in salivary gland, bone marrow, colon, stomach, polyp and larynx. No expression in small intestine. The 45 amino acid mature human BD3 shares 38% and 33% amino acid sequence identity with mouse and rat BD3, respectively.
Product Specifications
Gene Name
DEFB4A
Gene ID
100289462
UniProt
O15263
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 130mM NaCl, pH 7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items