Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human beta-Defensin 4A

Source: E.coli. MW :4.33kD. Recombinant Human beta-Defensin 4A is produced by our E.coli expression system and the target gene encoding Gly24-Pro64 is expressed. beta-Defensin 4A is a membrane-active cationic peptide that functions in inflammation and innate immune responses. There are at least 30 beta-Defensins, which are distinguished from a-Defensins by the connectivity pattern of their three intermolecular disulfide bonds. Members of the Defensin family are highly similar in protein sequence. This gene encodes Defensin, DEFB4; , which has broad-spectrum antimicrobial activity and may play an important role in innate epithelial defense. They are highly expressed in skin and tonsils, and to a lesser extent in trachea, uterus, kidney, thymus, adenoid, pharynx and tongue. beta-Defensin 4A has low expression in salivary gland, bone marrow, colon, stomach, polyp and larynx. No expression in small intestine. The 45 amino acid mature human BD3 shares 38% and 33% amino acid sequence identity with mouse and rat BD3, respectively.

Product Specifications

Gene Name

DEFB4A

Gene ID

100289462

UniProt

O15263

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 130mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galanin (1-13) -Spantide I (AA: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-D-Arg-Pro-Lys-Pro-Gln-Gln-D-Trp-Phe-D-Trp-Leu-Leu-NH2) (MW: 2828.34)
SP-101037-1 1 mg

Galanin (1-13) -Spantide I (AA: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-D-Arg-Pro-Lys-Pro-Gln-Gln-D-Trp-Phe-D-Trp-Leu-Leu-NH2) (MW: 2828.34)

Sign In for Pricing
View Details
Rabbit Polyclonal N4BP2 Antibody
NBP3-17277-25ul 25 µL

Rabbit Polyclonal N4BP2 Antibody

Sign In for Pricing
View Details
CSPG4LYP1 AAV siRNA Pooled Vector
55994161 1.0 µg

CSPG4LYP1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rabbit Polyclonal IFN-alpha G/IFNA5 Antibody [Alexa Fluor 594]
NBP2-99235AF594 0.1 mL

Rabbit Polyclonal IFN-alpha G/IFNA5 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Mouse Fam122b activation kit by CRISPRa
GA211023 1 Kit

Mouse Fam122b activation kit by CRISPRa

Sign In for Pricing
View Details
WFDC1 CRISPR Activation Plasmid (m)
sc-426789-ACT 20 µg

WFDC1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details