Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human beta-Defensin 4A

Source: E.coli. MW :4.33kD. Recombinant Human beta-Defensin 4A is produced by our E.coli expression system and the target gene encoding Gly24-Pro64 is expressed. beta-Defensin 4A is a membrane-active cationic peptide that functions in inflammation and innate immune responses. There are at least 30 beta-Defensins, which are distinguished from a-Defensins by the connectivity pattern of their three intermolecular disulfide bonds. Members of the Defensin family are highly similar in protein sequence. This gene encodes Defensin, DEFB4; , which has broad-spectrum antimicrobial activity and may play an important role in innate epithelial defense. They are highly expressed in skin and tonsils, and to a lesser extent in trachea, uterus, kidney, thymus, adenoid, pharynx and tongue. beta-Defensin 4A has low expression in salivary gland, bone marrow, colon, stomach, polyp and larynx. No expression in small intestine. The 45 amino acid mature human BD3 shares 38% and 33% amino acid sequence identity with mouse and rat BD3, respectively.

Product Specifications

Gene Name

DEFB4A

Gene ID

100289462

UniProt

O15263

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 130mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZNF313 (Ring Finger Protein 114, ZNF313) (MaxLight 490)
253739-ML490 100 µL

ZNF313 (Ring Finger Protein 114, ZNF313) (MaxLight 490)

Ask
View Details
TAZ sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
46222111 3x 1.0 µg

TAZ sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Ask
View Details
Recombinant Buxus microphylla Photosystem I assembly protein Ycf4 (ycf4)
MBS7033805-01 0.02 mg

Recombinant Buxus microphylla Photosystem I assembly protein Ycf4 (ycf4)

Ask
View Details
Recombinant Buxus microphylla Photosystem I assembly protein Ycf4 (ycf4)
MBS7033805-02 0.1 mg

Recombinant Buxus microphylla Photosystem I assembly protein Ycf4 (ycf4)

Ask
View Details
Recombinant Buxus microphylla Photosystem I assembly protein Ycf4 (ycf4)
MBS7033805-03 5x 0.1 mg

Recombinant Buxus microphylla Photosystem I assembly protein Ycf4 (ycf4)

Ask
View Details
Complement C3b, inactivated (iC3b, Complement Component 3, C3, AHUS5, ARMD9, ASP, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 1, CPAMD1) (Biotin)
MBS6248843-01 0.1 mL

Complement C3b, inactivated (iC3b, Complement Component 3, C3, AHUS5, ARMD9, ASP, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 1, CPAMD1) (Biotin)

Ask
View Details