Recombinant Human beta-Defensin 1/DEFB1
Source: E.coli. MW :5.07kD. Recombinant Human beta-Defensin 1 is produced by our E.coli expression system and the target gene encoding Gly22-Lys68 is expressed. beta-Defensin 1 (DEFB1) is a member of the beta-defensin family, which is highly expressed by epithelial cells. beta-defensins are expressed as the C-terminal portion of precursors and are released by proteolytic cleavage of a signal peptide. beta-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. beta-defensin 1 is an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. Defects in beta-Defensin-1 contribute to asthma diagnosis, with apparent gender-specific effects in human. beta-defensin 1 may also play a role in the pathogenesis of severe sepsis. In addition, beta-defensin 1 is associated with induction profiles in gingival keratinocytes.
Product Specifications
Gene Name
DEFB1
Gene ID
1672
UniProt
P60022
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 130mM NaCl, pH 7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items