Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human beta-Defensin 1/DEFB1

Source: E.coli. MW :5.07kD. Recombinant Human beta-Defensin 1 is produced by our E.coli expression system and the target gene encoding Gly22-Lys68 is expressed. beta-Defensin 1 (DEFB1) is a member of the beta-defensin family, which is highly expressed by epithelial cells. beta-defensins are expressed as the C-terminal portion of precursors and are released by proteolytic cleavage of a signal peptide. beta-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. beta-defensin 1 is an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. Defects in beta-Defensin-1 contribute to asthma diagnosis, with apparent gender-specific effects in human. beta-defensin 1 may also play a role in the pathogenesis of severe sepsis. In addition, beta-defensin 1 is associated with induction profiles in gingival keratinocytes.

Product Specifications

Gene Name

DEFB1

Gene ID

1672

UniProt

P60022

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 130mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human TLE6 shRNA (UAS) - Lentiviral human TLE6 shRNA (UAS, GFP) (100)
GTR15095769 1 Vial

Lentiviral human TLE6 shRNA (UAS) - Lentiviral human TLE6 shRNA (UAS, GFP) (100)

Ask
View Details
APC anti-mouse CD107a (LAMP-1)
GT02881 100 µg

APC anti-mouse CD107a (LAMP-1)

Ask
View Details
Plant Nuclear Factor KB P50 (NFKB-P50) ELISA Kit
MBS9374010 Inquire

Plant Nuclear Factor KB P50 (NFKB-P50) ELISA Kit

Ask
View Details
Thsd4 Mouse shRNA Plasmid (Locus ID 207596)
TL506223 1 Kit

Thsd4 Mouse shRNA Plasmid (Locus ID 207596)

Ask
View Details