Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human beta-Defensin 1/DEFB1

Source: E.coli. MW :5.07kD. Recombinant Human beta-Defensin 1 is produced by our E.coli expression system and the target gene encoding Gly22-Lys68 is expressed. beta-Defensin 1 (DEFB1) is a member of the beta-defensin family, which is highly expressed by epithelial cells. beta-defensins are expressed as the C-terminal portion of precursors and are released by proteolytic cleavage of a signal peptide. beta-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. beta-defensin 1 is an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. Defects in beta-Defensin-1 contribute to asthma diagnosis, with apparent gender-specific effects in human. beta-defensin 1 may also play a role in the pathogenesis of severe sepsis. In addition, beta-defensin 1 is associated with induction profiles in gingival keratinocytes.

Product Specifications

Gene Name

DEFB1

Gene ID

1672

UniProt

P60022

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 130mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GPR75 Rabbit Polyclonal Antibody
TA372667 100 µL

GPR75 Rabbit Polyclonal Antibody

Ask
View Details
PIH1D3 Antibody
E51A13111 100 µL

PIH1D3 Antibody

Ask
View Details
KDM4A
484102 100 µL

KDM4A

Ask
View Details
CYP20A1 Antibody, FITC conjugated
A58492-100UG 100 µg

CYP20A1 Antibody, FITC conjugated

Ask
View Details