Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytoglobin/CYGB (C-6His)

Source: E.coli. MW :22.44kD. Recombinant Human Cytoglobin is produced by our E.coli expression system and the target gene encoding Met1-Pro190 is expressed with a 6His tag at the C-terminus. Cytoglobin is a ubiquitously globin protein that belongs to the globin family. The highest expressed in heart, stomach, bladder and small intestine. CYGB acts a protector under conditions of oxidative stress. CYGB may be involved in intracellular oxygen storage or transfer, modulates oxygen and nitric oxide metabolism or scavenging free radicals within a cell.

Product Specifications

Gene Name

CYGB

Gene ID

114757

UniProt

Q8WWM9

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 10% Glycerol, pH 8.0 .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGPLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human FLJ22184 knockdown cell line
ABC-KD5592 1 Vial

Human FLJ22184 knockdown cell line

Ask
View Details
Rabbit Polyclonal VGF Antibody [DyLight 594]
NBP1-76906DL594 0.1 mL

Rabbit Polyclonal VGF Antibody [DyLight 594]

Ask
View Details
Rabbit Polyclonal STING/TMEM173 Antibody [PerCP]
NBP2-24683PCP 0.1 mL

Rabbit Polyclonal STING/TMEM173 Antibody [PerCP]

Ask
View Details
Lysophosphatidic Acid Receptor 3 CT (EDG-7)
MBS396440-01 0.05 mg

Lysophosphatidic Acid Receptor 3 CT (EDG-7)

Ask
View Details
Lysophosphatidic Acid Receptor 3 CT (EDG-7)
MBS396440-02 5x 0.05 mg

Lysophosphatidic Acid Receptor 3 CT (EDG-7)

Ask
View Details
Adiponectin (ADIPOQ) Mouse Monoclonal Antibody [Clone ID: LBI2E2]
AMM16584V 100 µL

Adiponectin (ADIPOQ) Mouse Monoclonal Antibody [Clone ID: LBI2E2]

Ask
View Details