Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytoglobin/CYGB (C-6His)

Source: E.coli. MW :22.44kD. Recombinant Human Cytoglobin is produced by our E.coli expression system and the target gene encoding Met1-Pro190 is expressed with a 6His tag at the C-terminus. Cytoglobin is a ubiquitously globin protein that belongs to the globin family. The highest expressed in heart, stomach, bladder and small intestine. CYGB acts a protector under conditions of oxidative stress. CYGB may be involved in intracellular oxygen storage or transfer, modulates oxygen and nitric oxide metabolism or scavenging free radicals within a cell.

Product Specifications

Gene Name

CYGB

Gene ID

114757

UniProt

Q8WWM9

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 10% Glycerol, pH 8.0 .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGPLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

REG1 beta (REG1B) Human shRNA Plasmid Kit (Locus ID 5968)
TL309877 1 Kit

REG1 beta (REG1B) Human shRNA Plasmid Kit (Locus ID 5968)

Ask
View Details
Casein α s1 (CSN1S1) Rat ELISA Kit
C1532 96 Tests

Casein α s1 (CSN1S1) Rat ELISA Kit

Ask
View Details
ABCA2 (ABC2, KIAA1062) discontinued
506415 100 µg

ABCA2 (ABC2, KIAA1062) discontinued

Ask
View Details
NSE (Y236) (Gamma-enolase, 2-phospho-D-glycerate Hydro-lyase, Neural Enolase, Neuron-specific Enolase, NSE, Enolase 2, ENO2, NSE) (Biotin) discontinued
N2175-01H-Biotin 200 µL

NSE (Y236) (Gamma-enolase, 2-phospho-D-glycerate Hydro-lyase, Neural Enolase, Neuron-specific Enolase, NSE, Enolase 2, ENO2, NSE) (Biotin) discontinued

Ask
View Details
SNTN Human shRNA Plasmid Kit (Locus ID 132203)
TR320933 1 Kit

SNTN Human shRNA Plasmid Kit (Locus ID 132203)

Ask
View Details
5-Carboxyfluorescein
F8901-01 100 mg

5-Carboxyfluorescein

Ask
View Details