Recombinant Human C-X-C Motif Chemokine 12/CXCL12/SDF-1 (22-93)
Source: E.coli. MW :8.53kD. Recombinant Human C-X-C Motif Chemokine 12 is produced by our E.coli expression system and the target gene encoding Lys22-Met93 is expressed. Stromal Cell-Derived Factor-1 (SDF-1) is a chemokine member of the intercrine family. SDF1 is expressed as five isoforms that differ only in the C terminal tail. SDF1a and SDF1 beta are identical except for the four residues present in the C-terminus of SDF1 beta but absent from SDF1a. SDF1 isoforms interact with CXCR4 and CXCR7 receptors on the cell surface, and can also bind syndecan4. SDF1 is known to influence lymphopoiesis, regulate patterning and cell number of neural progenitors, and promote angiogenesis. It also enhances the survival of myeloid progenitor cells.
Product Specifications
Gene Name
CXCL12
Gene ID
6387
UniProt
P48061
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog