Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human a B Crystallin Chain/CRYAB (C-6His)

Source: E.coli. MW :21.22kD. Recombinant Human CRYAB is produced by our E.coli expression system and the target gene encoding Met1-Lys175 is expressed with a 6His tag at the C-terminus. a Crystallin B Chain (CRYAB) is a cytoplasmic protein that belongs to the small heat shock protein (HSP20) family. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (sHSP also known as the HSP20) family. Alpha crystallins acts as molecular chaperones and hold them in in large soluble aggregates. CRYAB is expressed widely in many tissues and organs. It may contribute to the transparency and refractive index of the lens. The deficiency of CRYAB is the cause of myopathy myofibrillar type 2 (MFM2) and cataract posterior polar type 2 (CTPP2) .

Product Specifications

Gene Name

CRYAB

Gene ID

1410

UniProt

P02511

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKKLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Olr788 (NM_001000602) Rat Untagged Clone
RN206104 10 µg

Olr788 (NM_001000602) Rat Untagged Clone

Ask
View Details
Lentiviral human TRMT10A shRNA (UAS) - Lentiviral human TRMT10A shRNA (UAS) plasmid
GTR15141667 1 Vial

Lentiviral human TRMT10A shRNA (UAS) - Lentiviral human TRMT10A shRNA (UAS) plasmid

Ask
View Details
9-(2'-Deoxy-2'-fluoro-b-D-arabinofuranosyl)guanine
TRC-D239970-100MG 100 mg

9-(2'-Deoxy-2'-fluoro-b-D-arabinofuranosyl)guanine

Ask
View Details
Anti-Smooth Muscle Antibody (ASMA) BioAssayTM ELISA Kit (Human) discontinued
023471-01 48 Tests

Anti-Smooth Muscle Antibody (ASMA) BioAssayTM ELISA Kit (Human) discontinued

Ask
View Details
Anti-Smooth Muscle Antibody (ASMA) BioAssayTM ELISA Kit (Human) discontinued
023471-02 96 Tests

Anti-Smooth Muscle Antibody (ASMA) BioAssayTM ELISA Kit (Human) discontinued

Ask
View Details