Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 Ubiquitin-Protein Ligase CHIP/CHIP

Source: E.coli. MW :34.86kD. Recombinant Human STUB1 is produced by our E.coli expression system and the target gene encoding Met1-Tyr303 is expressed. E3 Ubiquitin-Protein Ligase CHIP is a cytoplasmic protein. CHIP is highly expressed in skeletal muscle, heart, pancreas, brain and placenta. CHIP interacts with the molecular chaperones Hsc70-Hsp70 and Hsp90 through its TPR domain; lead to in client substrate ubiquitylation and degradation by the proteasome. CHIP targets misfolded chaperone substrates towards proteasomal degradation. CHIP mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation. CHIP plays a role in base-excision repair: catalyzes polyubiquitination by amplifying the HUWE1/ARF-BP1-dependent monoubiquitination and leading to POLB-degradation by the proteasome. It also may regulate the receptor stability and activity through proteasomal degradation.

Product Specifications

Gene Name

STUB1

Gene ID

10273

UniProt

Q9UNE7

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TXNL4A Human shRNA Plasmid Kit (Locus ID 10907)
TL308547 1 Kit

TXNL4A Human shRNA Plasmid Kit (Locus ID 10907)

Ask
View Details
FEN1 Polyclonal Antibody, RBITC Conjugated
bs-9876R-RBITC 100 µL

FEN1 Polyclonal Antibody, RBITC Conjugated

Ask
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 58 (At2g03937)
MBS1395884-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Defensin-like protein 58 (At2g03937)

Ask
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 58 (At2g03937)
MBS1395884-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Defensin-like protein 58 (At2g03937)

Ask
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 58 (At2g03937)
MBS1395884-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Defensin-like protein 58 (At2g03937)

Ask
View Details
Recombinant Arabidopsis thaliana Defensin-like protein 58 (At2g03937)
MBS1395884-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Defensin-like protein 58 (At2g03937)

Ask
View Details